PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g27890
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 310aa    MW: 34321.6 Da    PI: 7.2389
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g27890genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-18137191256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++keq  +Lee F+++++++ +++  LA++l+L  rqV vWFqNrRa+ k
  CA01g27890 137 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALATQLNLRPRQVEVWFQNRRARTK 191
                 788899***********************************************98 PP

2HD-ZIP_I/II126.41.3e-40137226191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+++LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+kev eLr +l
   CA01g27890 137 RKKLRLSKEQAAVLEETFKEHNTLNPKQKLALATQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTAENRRLQKEVVELR-AL 226
                  69*************************************************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575120No hitNo description
PfamPF046182.2E-183118IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466892.18E-18126194IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-17133196IPR009057Homeodomain-like
PROSITE profilePS5007117.038133193IPR001356Homeobox domain
SMARTSM003897.9E-15135197IPR001356Homeobox domain
PfamPF000465.7E-16137191IPR001356Homeobox domain
CDDcd000862.29E-14137194No hitNo description
PROSITE patternPS000270168191IPR017970Homeobox, conserved site
PfamPF021832.6E-11193227IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.1E-24193236IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSGEKEDGLG LSLSLGIMSC PQQNKLKNYI TLSSSTPPPP PPLALNLLPF MHHHQSSSGR  60
NDEERGRVRG EIDMNEPARM IVECDNEQDD DDEEENQVIM VSSPNSTVSS VSGKRSHDEG  120
ERTTSSLEDD GGDAAARKKL RLSKEQAAVL EETFKEHNTL NPKQKLALAT QLNLRPRQVE  180
VWFQNRRART KLKQTEVDCE YLKRCCENLT AENRRLQKEV VELRALKLSP QLYMNMSPPT  240
TLTMCPQCER VAVSSSSSSA ASSSVNRPSA SRSHHHPEGA LHQAPVPLNK PWAAILAPKT  300
LGVQQRSQV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185193RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136131e-174BT013613.1 Lycopersicon esculentum clone 132414F, mRNA sequence.
GenBankX912121e-174X91212.1 L.esculentum mRNA for HD-ZIP protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544811.10.0PREDICTED: homeobox-leucine zipper protein HAT3-like
SwissprotP466021e-79HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLQ424371e-149Q42437_SOLLC; HD-ZIP protein
STRINGSolyc01g090460.2.11e-149(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.13e-71homeobox-leucine zipper protein 3